PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.12G100100.1.p
Common NameGLYMA_12G100100, LOC100782260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 762aa    MW: 82886.9 Da    PI: 5.867
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.12G100100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-2089144156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Glyma.12G100100.1.p  89 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 144
                          688999***********************************************999 PP

2START227.44.1e-712805001206
                          HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          ela +a++el+ +a+ +ep+W +      +++n+de++++f+++ +     ++ ea+r+++vv+m++++lve+l+d++ qW++ +     
  Glyma.12G100100.1.p 280 ELAVAAMEELIGMAQMGEPLWLTTLdgtsTMLNEDEYIRSFPRGIGpkpsgFKCEASRETAVVIMNHVNLVEILMDVN-QWSTVFSgivs 368
                          57899**************************************999********************************.*********** PP

                          EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          +a+tlev+s+g      galq+m+aelq+++plvp R+++fvRy++q+ +g+w++vdvS+d+ ++ p    ++R++++pSg+li++++ng
  Glyma.12G100100.1.p 369 RAMTLEVLSTGvagnynGALQVMTAELQLPTPLVPtRESYFVRYCKQHADGTWAVVDVSLDNLRPGP----SARCRRRPSGCLIQEMPNG 454
                          *******************************************************************....5****************** PP

                          EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          +skvtwvehv++++r +h+l+++lv+sg+a+gak+wvatl+rqce+
  Glyma.12G100100.1.p 455 YSKVTWVEHVEVDDRGVHNLYKQLVSSGHAFGAKRWVATLDRQCER 500
                          ********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-2368144IPR009057Homeodomain-like
SuperFamilySSF466891.5E-1977146IPR009057Homeodomain-like
PROSITE profilePS5007116.92586146IPR001356Homeobox domain
SMARTSM003891.2E-1987150IPR001356Homeobox domain
PfamPF000464.3E-1889144IPR001356Homeobox domain
CDDcd000862.70E-1989147No hitNo description
PROSITE patternPS000270121144IPR017970Homeobox, conserved site
SuperFamilySSF559612.91E-35271502No hitNo description
PROSITE profilePS5084843.887271503IPR002913START domain
CDDcd088756.91E-130275499No hitNo description
SMARTSM002342.0E-64280500IPR002913START domain
PfamPF018524.3E-60281500IPR002913START domain
Gene3DG3DSA:3.30.530.202.9E-5374482IPR023393START-like domain
SuperFamilySSF559612.14E-25520753No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010090Biological Processtrichome morphogenesis
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 762 aa     Download sequence    Send to blast
MQAGIMMIPA RNMPSMIARN NNVVGFFGSS ALFTLAQPNL MDALEMGQNT SESEVPRILE  60
DEFDSATKSG SENHEGASGE DQDPRPNKKK RYHRHTQHQI QEMEAFFKEC PHPDDKQRKE  120
LSRELGLEPL QVKFWFQNKR TQMKTQHERH ENTNLRTENE KLRADNMRYR EALSNASCPN  180
CGGPTAIGEM SFDEHHLRLE NARLREEIDR ISAIAAKYVG KPVVNYSNIS PSLPPRPLEL  240
GVGGAGFGGQ PGIGVDMYGA GDLLRSISGP TEADKPIIIE LAVAAMEELI GMAQMGEPLW  300
LTTLDGTSTM LNEDEYIRSF PRGIGPKPSG FKCEASRETA VVIMNHVNLV EILMDVNQWS  360
TVFSGIVSRA MTLEVLSTGV AGNYNGALQV MTAELQLPTP LVPTRESYFV RYCKQHADGT  420
WAVVDVSLDN LRPGPSARCR RRPSGCLIQE MPNGYSKVTW VEHVEVDDRG VHNLYKQLVS  480
SGHAFGAKRW VATLDRQCER LASAMATNIP TVDVGVITNQ DGRKSMMKLA ERMVISFCAG  540
VSASTAHTWT TLSGTGADDV RVMTRKSVDD PGRPPGIVLS AATSFWLPVP PKRVFDFLRD  600
ENSRNEWDIL SNGGVVQEMA HIANGRDTGN CVSLLRVNSA NSSQSNMLIL QESCTNSTGS  660
FVIYAPVDIV AMNVVLNGGD PDYVALLPSG FAILPDGTTS HNGSGGIGET GPSGSLLTVA  720
FQILVDSVPT AKLSLGSVAT VNNLIACTVE RIKASLSGEP A*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.252540.0cotyledon| flower| meristem| somatic embryo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539872.20.0PREDICTED: homeobox-leucine zipper protein HDG2-like isoform X1
RefseqXP_014620139.10.0PREDICTED: homeobox-leucine zipper protein HDG2-like isoform X1
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLK7LTZ80.0K7LTZ8_SOYBN; Uncharacterized protein
STRINGGLYMA12G10710.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15083499
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2